PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_89BA7115C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 271aa    MW: 30174.3 Da    PI: 5.8225
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_89BA7115C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161259148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+ll+ +v+q G g+W+++a+  g++R++k+c++rw +yl
  Traes_6AL_89BA7115C.1 12 KGPWTAQEDKLLLGYVRQQGDGRWNSVAKLTGLKRSGKSCRLRWVNYL 59
                           79********************************************97 PP

2Myb_DNA-binding51.13.2e-1665109147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Traes_6AL_89BA7115C.1  65 RGKITPQEETVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 109
                            8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.911759IPR017930Myb domain
SuperFamilySSF466894.49E-2910106IPR009057Homeodomain-like
SMARTSM007172.4E-131161IPR001005SANT/Myb domain
PfamPF002497.8E-161259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-231366IPR009057Homeodomain-like
CDDcd001674.83E-101459No hitNo description
PROSITE profilePS5129424.96460114IPR017930Myb domain
SMARTSM007175.4E-1564112IPR001005SANT/Myb domain
PfamPF002494.7E-1465109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2467112IPR009057Homeodomain-like
CDDcd001673.63E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
YGWGREEGGW RKGPWTAQED KLLLGYVRQQ GDGRWNSVAK LTGLKRSGKS CRLRWVNYLR  60
PDLKRGKITP QEETVILELH ALWGNRWSTI ARSLPGRTDN EIKNYWRTHF KKGKPSSKNI  120
ERARARFLKQ RREIMQGHHE HQRDVQDDDG AASADNNGDG AASHHADEAT TWPAPPPAQD  180
DDDLAMMRDM ADMDDFLQYH DPMSTSAYFL LNGGDGAASD AGSSGEIDAC GATWGSLWNL  240
DDLDVVDDVG GGGACGWGSF ALLQDHGLAF Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121127106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-139AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-139AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572719.11e-115PREDICTED: myb-related protein Zm38
TrEMBLW5G8G30.0W5G8G3_WHEAT; Uncharacterized protein
STRINGMLOC_6786.11e-157(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-65myb domain protein 79
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]